General Information

  • ID:  hor006573
  • Uniprot ID:  Q23430
  • Protein name:  Probable insulin-like peptide beta-type 4
  • Gene name:  ins-7
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008355 olfactory learning
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  IYRCGRRIHSYVFAVCGKACESNTEVNIASKCCREECTDDFIRKQCCP
  • Length:  48
  • Propeptide:  MPPIILVFFLVLIPASQQYPFSLESLNDQIINEEVIEYMLENSIRSSRTRRVPDEKKIYRCGRRIHSYVFAVCGKACESNTEVNIASKCCREECTDDFIRKQCCP
  • Signal peptide:  MPPIILVFFLVLIPASQQ
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin-like peptide which plays a role in ageing as a consequence of daf-16 activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-33; 16-46; 20-47; 32-37
  • Structure ID:  AF-Q23430-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006573_AF2.pdbhor006573_ESM.pdb

Physical Information

Mass: 634587 Formula: C229H367N71O71S8
Absent amino acids: LMW Common amino acids: C
pI: 7.97 Basic residues: 9
Polar residues: 19 Hydrophobic residues: 12
Hydrophobicity: -33.54 Boman Index: -11972
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 56.88
Instability Index: 7211.04 Extinction Coefficient cystines: 3480
Absorbance 280nm: 74.04

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  9548970
  • Title:  New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.
  • PubMed ID:  32366357
  • Title:  mRNA decapping is an evolutionarily conserved modulator of neuroendocrine signaling that controls development and ageing.